1.95 Rating by CuteStat

e94.org is 1 decade 2 years old. It is a domain having org extension. It has a global traffic rank of #12540162 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, e94.org is SAFE to browse.

PageSpeed Score
52
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 38
Daily Pageviews: 76

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: 1,540
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 12,540,162
Domain Authority: 17 ON 100

Web Server Information

Hosted IP Address:

96.125.161.206

Hosted Country:

United States of America US

Location Latitude:

29.7633

Location Longitude:

-95.3633

Websites Hosted on Same IP (i.e. 96.125.161.206)

Artikel-Schrijven.com

- artikel-schrijven.com

Artikel Schrijven Is Een Verzamelplaats Van Kwaliteits Artikelen. Artikel Schrijven Geeft Je Relevante Backlinks Voor Je Artikel En Een Hogere Ranking !

93,532 $ 88,560.00

VLR.co

- vlr.co

Its a Vlr.co

2,651,232 $ 240.00

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: Sep 3, 2011, 12:00 AM 1 decade 2 years 7 months ago
Last Modified: Sep 13, 2012, 12:00 AM 1 decade 1 year 7 months ago
Expiration Date: Sep 3, 2013, 12:00 AM 1 decade 7 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns827.hostgator.com 192.185.224.58 United States of America United States of America
ns828.hostgator.com 192.185.224.59 United States of America United States of America

Similarly Ranked Websites

Maternity Wear UK | Pregnancy Blog | Maternity Designer Clothes | Yumm

- mumzynot.com

Maternity Wear UK, Pregnancy Blog, Celeb baby blog and Maternity Designer Clothes. Maternity dress ideas, pregnancy style, maternity reviews for the Yummy Mummy complete Range of Maternity Dresses, Pregnancy Clothes and Maternity Clothes UK at Mumzy Not.

12,540,164 $ 8.95

The Billawar Association, Mumbai

- billawar.org
12,540,166 $ 8.95

Office of Cybersecurity and Communications | Homeland Security

- gallus-clothing.ch

The Office of Cybersecurity and Communications (CS&C) has the mission of assuring the security, resiliency, and reliability of the nation’s cyber and communications infrastructure.

12,540,169 $ 8.95

Canadian Log Home Supply Online Store

- clhs.ca

enter your site description here

12,540,180 $ 8.95

Bookie Rival

- bookierival.com

Earn $4000 every month from Matched Betting in Australia and New Zealand

12,540,198 $ 8.95